CD239/BCAM Rabbit mAb, Clone: [ARC2252], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19724S
Article Name: CD239/BCAM Rabbit mAb, Clone: [ARC2252], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19724S
Supplier Catalog Number: CNA19724S
Alternative Catalog Number: MBL-CNA19724S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 529-628 of human CD239/BCAM (P50895).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2252]
Molecular Weight: 67kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
Target: BCAM
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200