MEKK2 Rabbit mAb, Clone: [ARC2291], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19739S
Article Name: MEKK2 Rabbit mAb, Clone: [ARC2291], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19739S
Supplier Catalog Number: CNA19739S
Alternative Catalog Number: MBL-CNA19739S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK2 (Q9Y2U5).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2291]
Molecular Weight: 70kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLD
Target: MAP3K2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200