RING1A Rabbit mAb, Clone: [ARC2278], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19750S
Article Name: RING1A Rabbit mAb, Clone: [ARC2278], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19750S
Supplier Catalog Number: CNA19750S
Alternative Catalog Number: MBL-CNA19750S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RING1A A (Q06587).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2278]
Molecular Weight: 42kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAP
Target: RING1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000