alpha Sarcoglycan (SGCA) Rabbit mAb, Clone: [ARC2280], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19754S
Article Name: alpha Sarcoglycan (SGCA) Rabbit mAb, Clone: [ARC2280], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19754S
Supplier Catalog Number: CNA19754S
Alternative Catalog Number: MBL-CNA19754S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2280]
Molecular Weight: 43kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: VDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH
Target: SGCA
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200