SLC22A3/OCT3 Rabbit mAb, Clone: [ARC2285], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19758S
Article Name: SLC22A3/OCT3 Rabbit mAb, Clone: [ARC2285], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19758S
Supplier Catalog Number: CNA19758S
Alternative Catalog Number: MBL-CNA19758S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2285]
Molecular Weight: 61kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVTAFLPEGIAWLRTTVATLGRLGITMAF
Target: SLC22A3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200