Syntrophin alpha 1 Rabbit mAb, Clone: [ARC2286], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19759S
Article Name: Syntrophin alpha 1 Rabbit mAb, Clone: [ARC2286], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19759S
Supplier Catalog Number: CNA19759S
Alternative Catalog Number: MBL-CNA19759S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntrophin alpha 1 (Q13424).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2286]
Molecular Weight: 54kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTVRKADAGGLGI
Target: SNTA1
Application Dilute: WB: WB,1:500 - 1:2000