ERp29 Rabbit mAb, Clone: [ARC2295], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19771S
Article Name: ERp29 Rabbit mAb, Clone: [ARC2295], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19771S
Supplier Catalog Number: CNA19771S
Alternative Catalog Number: MBL-CNA19771S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2295]
Molecular Weight: 29kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM
Target: ERP29
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200