Transportin 3 (TNPO3) Rabbit mAb, Clone: [ARC2310], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19774S
Article Name: Transportin 3 (TNPO3) Rabbit mAb, Clone: [ARC2310], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19774S
Supplier Catalog Number: CNA19774S
Alternative Catalog Number: MBL-CNA19774S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (Transportin 3 (TNPO3)) (Q9Y5L0).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2310]
Molecular Weight: 104kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLFR
Target: TNPO3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200