KRAS+HRAS+NRAS Rabbit mAb, Clone: [ARC2369], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19779S
Article Name: KRAS+HRAS+NRAS Rabbit mAb, Clone: [ARC2369], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19779S
Supplier Catalog Number: CNA19779S
Alternative Catalog Number: MBL-CNA19779S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-188 of human NRAS (P01111).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2369]
Molecular Weight: 21kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVV
Target: HRAS/KRAS/KRAS
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200