RPL5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1977S
Article Name: RPL5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1977S
Supplier Catalog Number: CNA1977S
Alternative Catalog Number: MBL-CNA1977S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 34kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY
Target: RPL5
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200