Sec61A Rabbit mAb, Clone: [ARC2323], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19795S
Article Name: Sec61A Rabbit mAb, Clone: [ARC2323], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19795S
Supplier Catalog Number: CNA19795S
Alternative Catalog Number: MBL-CNA19795S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2323]
Molecular Weight: 52kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: SMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLA
Target: SEC61A2
Application Dilute: WB: WB,1:500 - 1:1000