Mast Cell Tryptase (TPSB2) Rabbit mAb, Clone: [ARC2328], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19801S
Article Name: Mast Cell Tryptase (TPSB2) Rabbit mAb, Clone: [ARC2328], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19801S
Supplier Catalog Number: CNA19801S
Alternative Catalog Number: MBL-CNA19801S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-275 of human Mast Cell Tryptase (TPSB2) (TPSB2) (P20231).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2328]
Molecular Weight: 31kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Target: TPSB2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200