CTIP2/BCL11B Rabbit mAb, Clone: [ARC2329], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19804S
Article Name: CTIP2/BCL11B Rabbit mAb, Clone: [ARC2329], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19804S
Supplier Catalog Number: CNA19804S
Alternative Catalog Number: MBL-CNA19804S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human CTIP2/BCL11B (Q9C0K0).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2329]
Molecular Weight: 96kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEEEELLLENES
Target: BCL11B
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200