Tubulin beta-1 chain Rabbit mAb, Clone: [ARC2484], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19805S
Article Name: Tubulin beta-1 chain Rabbit mAb, Clone: [ARC2484], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19805S
Supplier Catalog Number: CNA19805S
Alternative Catalog Number: MBL-CNA19805S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Bovine, Canine, Human, Monkey, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 352-451 of human Tubulin beta-1 chain (Q9H4B7).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2484]
Molecular Weight: 50kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: AVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Target: TUBB1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200