Musashi-2 (MSI2) Rabbit mAb, Clone: [ARC2341], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19814S
Article Name: Musashi-2 (MSI2) Rabbit mAb, Clone: [ARC2341], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19814S
Supplier Catalog Number: CNA19814S
Alternative Catalog Number: MBL-CNA19814S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Musashi-2 (MSI2) (Q96DH6).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2341]
Molecular Weight: 35kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS
Target: MSI2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200