eIF2C3 Rabbit mAb, Clone: [ARC2345], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19819S
Article Name: eIF2C3 Rabbit mAb, Clone: [ARC2345], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19819S
Supplier Catalog Number: CNA19819S
Alternative Catalog Number: MBL-CNA19819S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 721-860 of human eIF2C3 (Q9H9G7).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2345]
Molecular Weight: 97kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDPQALAKAVQIHQDTLRTMYFA
Target: AGO3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200