ACVR2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1981P
Article Name: ACVR2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1981P
Supplier Catalog Number: CNA1981P
Alternative Catalog Number: MBL-CNA1981P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 228-325 of human ACVR2A (NP_001607.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 58kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKS
Target: ACVR2A
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200