HLA-DRB1 Rabbit mAb, Clone: [ARC2360], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19835S
Article Name: HLA-DRB1 Rabbit mAb, Clone: [ARC2360], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19835S
Supplier Catalog Number: CNA19835S
Alternative Catalog Number: MBL-CNA19835S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HLA-DRB1 (P01911).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2360]
Molecular Weight: 30kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Target: HLA-DRB1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200