INSIG2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1992P
Article Name: INSIG2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1992P
Supplier Catalog Number: CNA1992P
Alternative Catalog Number: MBL-CNA1992P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human INSIG2 (NP_057217.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: QIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDR
Target: INSIG2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200