[KO Validated] BRD4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA20019T
| Article Name: |
[KO Validated] BRD4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA20019T |
| Supplier Catalog Number: |
CNA20019T |
| Alternative Catalog Number: |
MBL-CNA20019T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 623-722 of human BRD4 (NP_055114.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
80kDa/88kDa/152kDa |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
NKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETGPA |
| Target: |
BRD4 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
