SARS-CoV-2 Spike S1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20136T
Article Name: SARS-CoV-2 Spike S1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20136T
Supplier Catalog Number: CNA20136T
Alternative Catalog Number: MBL-CNA20136T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: DOT, IF, IP, WB
Species Reactivity: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 11-682 of coronavirus Spike S1 (YP_009724390.1).
Conjugation: Unconjugated
Alternative Names: sars-cov-2
Clonality: Polyclonal
Molecular Weight: 141kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAA
Target: Spike S1
Application Dilute: WB: DB,1:500 - 1:2000|ELISA,1:20000-1:80000|WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500|IP,1:2000 - 1:10000