TMEM61 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20151T
Article Name: TMEM61 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20151T
Supplier Catalog Number: CNA20151T
Alternative Catalog Number: MBL-CNA20151T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 91-210 of human TMEM61 (NP_872338.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 22kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ASIPGPPRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARGGS
Target: TMEM61
Application Dilute: WB: WB,1:500 - 1:1000