LPAR4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20157T
Article Name: LPAR4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20157T
Supplier Catalog Number: CNA20157T
Alternative Catalog Number: MBL-CNA20157T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 311-370 of human LPAR4 (Q99677).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Target: LPAR4
Application Dilute: WB: WB,1:500 - 1:1000