HRH1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20159T
Article Name: HRH1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20159T
Supplier Catalog Number: CNA20159T
Alternative Catalog Number: MBL-CNA20159T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-340 of human HRH1 (NP_000852.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 56kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNT
Target: HRH1
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200