PCNT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20161T
Article Name: PCNT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20161T
Supplier Catalog Number: CNA20161T
Alternative Catalog Number: MBL-CNA20161T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 95-212 of human PCNT (NP_006022.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 378kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GEKREDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTISDHPAEQRGMFT
Target: PCNT
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200