ATP6V1G2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20163T
Article Name: ATP6V1G2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20163T
Supplier Catalog Number: CNA20163T
Alternative Catalog Number: MBL-CNA20163T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-100 of human ATP6V1G2 (NP_569730.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 14kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLL
Target: ATP6V1G2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200