RING1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20171T
Article Name: RING1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20171T
Supplier Catalog Number: CNA20171T
Alternative Catalog Number: MBL-CNA20171T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 207-406 of human RING1A A (NP_002922.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
Target: RING1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200