ZNF207 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20177T
Article Name: ZNF207 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20177T
Supplier Catalog Number: CNA20177T
Alternative Catalog Number: MBL-CNA20177T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human ZNF207 (NP_003448.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 51kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGI
Target: ZNF207
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200