SLBP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20178T
Article Name: SLBP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20178T
Supplier Catalog Number: CNA20178T
Alternative Catalog Number: MBL-CNA20178T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 125-223 of human SLBP (NP_006518.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 31kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PADFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLESAESSSE
Target: SLBP
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200