USP11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20179T
Article Name: USP11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20179T
Supplier Catalog Number: CNA20179T
Alternative Catalog Number: MBL-CNA20179T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human USP11 (NP_004642.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 110kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQ
Target: USP11
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200