RAD54L Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20181T
Article Name: RAD54L Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20181T
Supplier Catalog Number: CNA20181T
Alternative Catalog Number: MBL-CNA20181T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 648-747 of human RAD54L (Q92698).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 84kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR
Target: RAD54L
Application Dilute: WB: WB,1:500 - 1:1000