LLGL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20205T
Article Name: LLGL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20205T
Supplier Catalog Number: CNA20205T
Alternative Catalog Number: MBL-CNA20205T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human LLGL1 (NP_004131.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 115kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYR
Target: LLGL1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200