[KO Validated] Bax Rabbit mAb, Clone: [ARC5006-10], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20227P
Article Name: [KO Validated] Bax Rabbit mAb, Clone: [ARC5006-10], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20227P
Supplier Catalog Number: CNA20227P
Alternative Catalog Number: MBL-CNA20227P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC5006-10]
Molecular Weight: 21kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
Target: BAX
Application Dilute: WB: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500