CD31/PECAM1 Rabbit mAb, Clone: [ARC5013-19], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20228T
Article Name: CD31/PECAM1 Rabbit mAb, Clone: [ARC5013-19], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20228T
Supplier Catalog Number: CNA20228T
Alternative Catalog Number: MBL-CNA20228T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC5013-19]
Molecular Weight: 83KDa
Buffer: PBS with 0.01% thimerosal,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,0.05% BSA,50% glycerol
Sequence: AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Target: PECAM1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000