SARS-CoV-2 ORF3A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20234T
Article Name: SARS-CoV-2 ORF3A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20234T
Supplier Catalog Number: CNA20234T
Alternative Catalog Number: MBL-CNA20234T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus ORF3A (YP_009724391.1).
Conjugation: Unconjugated
Alternative Names: sars-cov-2
Clonality: Polyclonal
Molecular Weight: 31kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: GLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDC
Target: ORF3A
Application Dilute: WB: WB,1:2000 - 1:6000