CKM Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2024S
Article Name: CKM Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2024S
Supplier Catalog Number: CNA2024S
Alternative Catalog Number: MBL-CNA2024S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-381 of human CKM (NP_001815.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 43kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFC
Target: CKM
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:20 - 1:200