CCR3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20253T
Article Name: CCR3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20253T
Supplier Catalog Number: CNA20253T
Alternative Catalog Number: MBL-CNA20253T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence within amino acids 146-226 of human CCR3 (NP_001828.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 41kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTL
Target: CCR3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200