GALNT7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20259T
Article Name: GALNT7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20259T
Supplier Catalog Number: CNA20259T
Alternative Catalog Number: MBL-CNA20259T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-130 of human GALNT7 (NP_059119.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 75kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPG
Target: GALNT7
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200