SARS-CoV-2 NSP2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA20280T
| Article Name: |
SARS-CoV-2 NSP2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA20280T |
| Supplier Catalog Number: |
CNA20280T |
| Alternative Catalog Number: |
MBL-CNA20280T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Virus |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of coronavirus NSP2 (YP_009742609.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
sars-cov-2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
794kDa |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
SWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASAN |
| Target: |
NSP2 |
| Application Dilute: |
WB: WB,1:2000 - 1:6000 |
