SARS-CoV-2 NSP4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20281T
Article Name: SARS-CoV-2 NSP4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20281T
Supplier Catalog Number: CNA20281T
Alternative Catalog Number: MBL-CNA20281T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 399-499 of coronavirus NSP4 (YP_009725300.1).
Conjugation: Unconjugated
Alternative Names: sars-cov-2
Clonality: Polyclonal
Molecular Weight: 794kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVL
Target: NSP4
Application Dilute: WB: WB,1:500 - 1:1000