[KO Validated] CD73/NT5E Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2029T
Article Name: [KO Validated] CD73/NT5E Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2029T
Supplier Catalog Number: CNA2029T
Alternative Catalog Number: MBL-CNA2029T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 32-264 of human CD73/NT5E (NP_002517.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 63kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYP
Target: NT5E
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200