SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20307T
Article Name: SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20307T
Supplier Catalog Number: CNA20307T
Alternative Catalog Number: MBL-CNA20307T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1).
Conjugation: Unconjugated
Alternative Names: sars-cov-2
Clonality: Polyclonal
Molecular Weight: 14kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1).
Application Dilute: WB: WB,1:500 - 1:1000