SARS-CoV-2 NSP6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20322P
Article Name: SARS-CoV-2 NSP6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20322P
Supplier Catalog Number: CNA20322P
Alternative Catalog Number: MBL-CNA20322P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 236-290 of coronavirus NSP6 (YP_009725302.1).
Conjugation: Unconjugated
Alternative Names: sars-cov-2
Clonality: Polyclonal
Molecular Weight: 794kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 236-290 of coronavirus NSP6 (YP_009725302.1).
Application Dilute: WB: WB,1:500 - 1:1000