PCK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2036P
Article Name: PCK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2036P
Supplier Catalog Number: CNA2036P
Alternative Catalog Number: MBL-CNA2036P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 490-622 of human PCK1 (NP_002582.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 69kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: FGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 490-622 of human PCK1 (NP_002582.3).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000