TriMethyl-Histone H3-K36 Rabbit mAb, Clone: [ARC50050], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20379P
Article Name: TriMethyl-Histone H3-K36 Rabbit mAb, Clone: [ARC50050], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20379P
Supplier Catalog Number: CNA20379P
Alternative Catalog Number: MBL-CNA20379P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, DOT, IHC-P, IP, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC50050]
Molecular Weight: 15kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target: A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Application Dilute: WB: DB,1:500 - 1:1000|WB,1:500 - 1:1000|IP,1:500 - 1:1000|IHC-P,1:50 - 1:200|ChIP,1:50 - 1:200|ChIP-seq,1:50 - 1:100