alpha-Synuclein Rabbit mAb, Clone: [ARC50333], Unconjugated, Monoclonal

Catalog Number: MBL-CNA20407P
Article Name: alpha-Synuclein Rabbit mAb, Clone: [ARC50333], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA20407P
Supplier Catalog Number: CNA20407P
Alternative Catalog Number: MBL-CNA20407P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 59-140 of human alpha-Synuclein (NP_000336.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC50333]
Molecular Weight: 14kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: TKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 59-140 of human alpha-Synuclein (NP_000336.1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200