TIGAR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20416P
Article Name: TIGAR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20416P
Supplier Catalog Number: CNA20416P
Alternative Catalog Number: MBL-CNA20416P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIGAR (NP_065108.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 30kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGA
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIGAR (NP_065108.1).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200