Prdm9 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA20428P
| Article Name: |
Prdm9 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA20428P |
| Supplier Catalog Number: |
CNA20428P |
| Alternative Catalog Number: |
MBL-CNA20428P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
97kDa |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIF |
| Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse Prdm9 (NP_659058.3). |
| Application Dilute: |
WB: WB,1:500 - 1:1000|ChIP,1:50 - 1:200 |
