CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20478P
Article Name: CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20478P
Supplier Catalog Number: CNA20478P
Alternative Catalog Number: MBL-CNA20478P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 611-678 of rat CD31/PECAM1 (NP_113779.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 76kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: YFLRKAKAKQKPVEMSRPAVPLLNSNSEKVSEPSVETNSHYDSQNMDVEYTEVEVSSLEPHQENGRLP
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 611-678 of rat CD31/PECAM1 (NP_113779.1).
Application Dilute: WB: WB,1:500 - 1:1000