N4BP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA20480P
Article Name: N4BP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA20480P
Supplier Catalog Number: CNA20480P
Alternative Catalog Number: MBL-CNA20480P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human N4BP2 (NP_060647.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 199kDa
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: IFSTQNMNLNGENLENSGSTLSLNPLPSHSVLNESKCFIKDNTLALESNYPEDSLLSSSLNVASDSIAGCSSLNQKQKELLESECVEAQFSEAPVDLDASEPQACLNLPGLDLPGTGGDQKSTRVSDVFLP
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human N4BP2 (NP_060647.2).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200